PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G01023
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 409aa    MW: 46696.4 Da    PI: 7.5876
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G01023genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.8e-17180226148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g WT +Ed  lv++v+++G++ W+ Ia++++ gR +kqc++rw+++l
       AA53G01023 180 KGQWTSDEDRSLVHLVELHGTKKWSQIAKMLQ-GRVGKQCRERWHNHL 226
                      799*****************************.*************97 PP

2Myb_DNA-binding57.43.4e-18233274245
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + WT+eEd++l++a+k+ G++ W+ Iar+++ gRt++ +k++w+
       AA53G01023 233 DGWTEEEDKILIQAHKEIGNR-WAEIARKLP-GRTENTIKNHWN 274
                      56*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129428.452175230IPR017930Myb domain
SuperFamilySSF466892.7E-31177273IPR009057Homeodomain-like
SMARTSM007177.8E-15179228IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-27181234IPR009057Homeodomain-like
CDDcd001672.50E-13183226No hitNo description
PfamPF139212.1E-16183238No hitNo description
PROSITE profilePS5129420.893231281IPR017930Myb domain
SMARTSM007179.3E-17231279IPR001005SANT/Myb domain
CDDcd001674.61E-13235277No hitNo description
Gene3DG3DSA:1.10.10.601.7E-21235279IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010439Biological Processregulation of glucosinolate biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1904095Biological Processnegative regulation of endosperm development
GO:2000692Biological Processnegative regulation of seed maturation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 409 aa     Download sequence    Send to blast
MEFKSVIKMQ YPYLAAVLYD DNNLTLENFH QSFNDQYHSR SSSLSSMINS TSDHHHFDVQ  60
SQAAYEIPSK DIIMDITSYP CSETFNTHLH GISNDQDLFN LAYCTESKGI SDILHLSQTN  120
TPQNGIVHNL FDPSQRLTSG SRAEPFHQDQ EMVKNDQIKK HRRLQMRRGC KASKKASIIK  180
GQWTSDEDRS LVHLVELHGT KKWSQIAKML QGRVGKQCRE RWHNHLRPDI KKDGWTEEED  240
KILIQAHKEI GNRWAEIARK LPGRTENTIK NHWNATKRRQ HSRRTKGKDE ITLTVGNNTL  300
QNYIRSVSFN ENTHMMTTTR GKGKFVIVED NNNNNKDLVD GMMMNLDLEG VTHTTPASGS  360
ASTSASASAS GVTTEFDEPV TDSWMVMHGC DEVMMKEIAL LEMIAHGRL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C2e-461782802104C-Myb DNA-Binding Domain
1msf_C2e-461782802104C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00385DAPTransfer from AT3G27785Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0181143e-31AB018114.1 Arabidopsis thaliana genomic DNA, chromosome 3, P1 clone: MGF10.
GenBankAF3348173e-31AF334817.2 Arabidopsis thaliana putative transcription factor (MYB118) mRNA, complete cds.
GenBankAY5503063e-31AY550306.1 Arabidopsis thaliana MYB transcription factor (At3g27785) mRNA, complete cds.
GenBankCP0026863e-31CP002686.1 Arabidopsis thaliana chromosome 3, complete sequence.
GenBankDQ4467083e-31DQ446708.1 Arabidopsis thaliana clone pENTR221-At3g27785 myb family transcription factor (At3g27785) mRNA, complete cds.
GenBankDQ6531113e-31DQ653111.1 Arabidopsis thaliana clone 0000013325_0000009613 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395402.11e-166hypothetical protein EUTSA_v10005564mg
TrEMBLV4KZ101e-166V4KZ10_EUTSA; Uncharacterized protein
STRINGAT3G27785.11e-151(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM60522643
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27785.11e-149myb domain protein 118